Technical Support: support.menoci@@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Primary antibodies
Search
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | umg-sfb1002-antibody-primary-961 | AB_528376 | S46 | monoclonal | Purified myosin from Pectoralis major. This antigen is also known as myosin heavy chain, cardiac muscle alpha isoform. Uniprot ID: P13533 , https://www.uniprot.org/uniprot/P13533 | - | |||
| umg-sfb1002-antibody-primary-1025 | PECAM1 | AB_726362 | Anti-CD31 antibody | polyclonal | Synthetic peptide within Mouse CD31 aa 700 to the C-terminus (C terminal). The exact sequence is proprietary. Database link: Q08481, http://www.uniprot.org/uniprot/Q08481 | - | Abcam | ab28364 |
| umg-sfb1002-antibody-primary-1026 | ITGB1 | AB_2128061 | Anti-Integrin β1 Antibody, a.a. 82-87, clone JB1A (a.k.a. J10) | monoclonal | Purified beta 1 integrin and Jurkat cells | - | Millipore | MAB1965 |
| umg-sfb1002-antibody-primary-1027 | MYH7 | AB_528385 | Human β Myosin heavy chain | monoclonal | - | Developmental Studies Hybridoma Bank | A4.951 | |
| umg-sfb1002-antibody-primary-1028 | TNNT1 | AB_956386 | Anti-Cardiac Troponin T antibody | polyclonal | Synthetic peptide conjugated to KLH derived from within residues 50 - 150 of Human cardiac Troponin T. Read Abcam's proprietary immunogen policy (Peptide available as ab47005. https://www.abcam.com/ab47005.) | - | Abcam | ab45932 |
| umg-sfb1002-antibody-primary-1029 | MYL2 | AB_10645889 | MLC-2V | polyclonal | Synthetic peptide corresponding to AA 104 to 118 from mouse MLC-2V (UniProt Id: P51667, http://www.uniprot.org/uniprot/P51667) | - | Synaptic Systems | 310003 |
| umg-sfb1002-antibody-primary-1030 | MYL2 | AB_887737 | MLC-2A | monoclonal | Recombinant protein corresponding to AA 1 to 175 from human MLC-2A (UniProt Id: Q01449, http://www.uniprot.org/uniprot/Q01449) | - | Synaptic Systems | 311 011 |
| umg-sfb1002-antibody-primary-1031 | MYOM1 | AB_10696312 | MYOM1-Specific Antibody | polyclonal | myomesin 1, GenBank accession number: NM_003803 | - | Proteintech | 20360-1-AP |
| umg-sfb1002-antibody-primary-1032 | CDH2 | AB_2683760 | Anti-CDH2 Antibody | polyclonal | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence, NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP | - | Atlas Antibodies | HPA058574 |
| umg-sfb1002-antibody-primary-1033 | MKI67 | AB_10979488 | Ki-67 Monoclonal Antibody (SP6) | monoclonal | A synthetic peptide derived from the human Ki-67 protein | - | ThermoFisher Scientific | MA5-14520 |
| umg-sfb1002-antibody-primary-1298 | AB_1163380 | Anti-Aquaporin 1 antibody | polyclonal | Aquaporin 1 r | - | Millipore | AB2219 | |
| umg-sfb1002-antibody-primary-1299 | HSP90AA1 | AB_397799 | Hsp90 | unknown | - | BD Biosciences | 610419 | |
| umg-sfb1002-antibody-primary-1300 | AQP1 | AB_626693 | AQP1 (1/22) antibody | monoclonal | - | Santa Cruz Biotechnology | sc-32737 | |
| umg-sfb1002-antibody-primary-1301 | AB_310331 | Anti-p47-phox antibody | polyclonal | p47-phox | - | Millipore | 07-001 | |
| umg-sfb1002-antibody-primary-1548 | NKX2-5 | AB_355269 | NKX2.5 Antibody | polyclonal | E. coli-derived recombinant human NKX2.5 Gln24-Arg137 Accession # P52952 | - | R&D Systems | AF2444 |
| umg-sfb1002-antibody-primary-1549 | SSEA4 | SSEA4 (MC813) Mouse mAb | monoclonal | - | Cell Signaling Technology | 4755 | ||
| umg-sfb1002-antibody-primary-1550 | AB_2119059 | TRA-1-60(S) (TRA-1-60(S)) Mouse mAb | monoclonal | - | Cell Signaling Technology | 4746 | ||
| umg-sfb1002-antibody-primary-1551 | Anti-Cardiac Troponin T antibody [1F11] | monoclonal | Peptide 146-160 | - | Abcam | ab10214 | ||
| umg-sfb1002-antibody-primary-1552 | TNNT2 | AB_2751735 | Cardiac Troponin T Antibody, anti-human/mouse/rat, REAfinity™ | unknown | - | Miltenyi Biotec | 130-119-575 | |
| umg-sfb1002-antibody-primary-1553 | MYL2 | AB_2652947 | MLC2v Antibody, anti-human/mouse/rat, REAfinity™ | unknown | - | Miltenyi Biotec | 130-106-134 | |
| umg-sfb1002-antibody-primary-1554 | AB_2733688 | REA Control Antibody, human IgG1, REAfinity™ | unknown | - | Miltenyi Biotec | 130-113-449 | ||
| umg-sfb1002-antibody-primary-1555 | AB_2733446 | REA Control Antibody, human IgG1, REAfinity™ | unknown | - | Miltenyi Biotec | 130-113-446 | ||
| umg-sfb1002-antibody-primary-978 | TTN | Conos titin custom antibody | unknown | entire N-terminal, Cronos titin-specific sequene excluding the start methionine: SNAKLFLPSRLA. | - | |||
| umg-sfb1002-antibody-primary-1005 | AB_1549585 | HA-Tag (C29F4) Rabbit mAb | monoclonal | synthetic peptide containing the influenza hemagglutinin epitope (YPYDVPDYA). | - | Cell Signaling Technology | 3724 | |
| umg-sfb1002-antibody-primary-1006 | ATP5IF1 | AB_10949890 | ATPIF1 Antibody | polyclonal | - | Cell Signaling Technology | 8528 |
