Technical Support: support.menoci@@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Primary antibodies
Search
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | umg-sfb1002-antibody-primary-989 | BMPR2 | AB_10865487 | Anti-BMPR2 antibody | polyclonal | Recombinate fragment, corresponding to amino acids 295 - 552 of Human BMPR2 (BC052985). | - | Abcam | ab106266 |
| umg-sfb1002-antibody-primary-991 | POU5F1 | AB_445175 | Anti-Oct4 antibody - ChIP Grade | polyclonal | Synthetic peptide corresponding to Human Oct4 aa 300 to the C-terminus (C terminal) conjugated to keyhole limpet haemocyanin. (Peptide available as ab20650, https://www.abcam.com/ab20650.html) | - | Abcam | ab19857 |
| umg-sfb1002-antibody-primary-993 | SOX2 | AB_945584 | Anti-SOX2 antibody - ChIP Grade | polyclonal | Synthetic peptide made from the N-terminal region of human SOX2 protein within residues 1-100. | - | Abcam | ab59776 |
| umg-sfb1002-antibody-primary-994 | DPPA3 | AB_2246120 | Anti-STELLAR antibody | polyclonal | Synthetic peptide corresponding to Mouse STELLAR aa 100 to the C-terminus (C terminal) conjugated to keyhole limpet haemocyanin. (Peptide available as ab23324, https://www.abcam.com/ab23324.html) | - | Abcam | ab19878 |
| umg-sfb1002-antibody-primary-995 | AB_2615077 | Histone H3K4me3 antibody | polyclonal | This Histone H3 trimethyl Lys4 antibody was raised against a peptide including trimethyl-lysine 4 of histone H3. | - | Active Motif | 39159 | |
| umg-sfb1002-antibody-primary-996 | AB_310624 | Antibody against Homo sapiens H3K27me3, Mus musculus H3K27me3 | polyclonal | KLH-conjugated, synthetic 2X-branched peptide containing the sequence â¦AR(me3K)SAP⦠in which me3K corresponds to trimethyl-lysine at residue 27 of human histone H3. | - | Millipore | 07-449 | |
| umg-sfb1002-antibody-primary-998 | KCNK17 | Anti-KCNK17 antibody - N-terminal | polyclonal | - | Abcam | ab198043 | ||
| umg-sfb1002-antibody-primary-1001 | KCNK3 | AB_2040132 | Anti-KCNK3 (TASK-1) Antibody | polyclonal | Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human KCNK3 (Accession O14649). Intracellular, C-terminal part. | - | Alomone Labs | APC-024 |
| umg-sfb1002-antibody-primary-1003 | CASQ1 | AB_303865 | Anti-Calsequestrin antibody | polyclonal | - | Abcam | ab3516 | |
| umg-sfb1002-antibody-primary-1004 | AB_2687626 | m-IgGκ BP-HRP | polyclonal | - | Santa Cruz Biotechnology | sc-516102 | ||
| umg-sfb1002-antibody-primary-1006 | ATP5IF1 | AB_10949890 | ATPIF1 Antibody | polyclonal | - | Cell Signaling Technology | 8528 | |
| umg-sfb1002-antibody-primary-1007 | LETM1 | AB_1950806 | LETM1 antibody | polyclonal | - | GeneTex | GTX112455 | |
| umg-sfb1002-antibody-primary-1025 | PECAM1 | AB_726362 | Anti-CD31 antibody | polyclonal | Synthetic peptide within Mouse CD31 aa 700 to the C-terminus (C terminal). The exact sequence is proprietary. Database link: Q08481, http://www.uniprot.org/uniprot/Q08481 | - | Abcam | ab28364 |
| umg-sfb1002-antibody-primary-1028 | TNNT1 | AB_956386 | Anti-Cardiac Troponin T antibody | polyclonal | Synthetic peptide conjugated to KLH derived from within residues 50 - 150 of Human cardiac Troponin T. Read Abcam's proprietary immunogen policy (Peptide available as ab47005. https://www.abcam.com/ab47005.) | - | Abcam | ab45932 |
| umg-sfb1002-antibody-primary-1029 | MYL2 | AB_10645889 | MLC-2V | polyclonal | Synthetic peptide corresponding to AA 104 to 118 from mouse MLC-2V (UniProt Id: P51667, http://www.uniprot.org/uniprot/P51667) | - | Synaptic Systems | 310003 |
| umg-sfb1002-antibody-primary-1031 | MYOM1 | AB_10696312 | MYOM1-Specific Antibody | polyclonal | myomesin 1, GenBank accession number: NM_003803 | - | Proteintech | 20360-1-AP |
| umg-sfb1002-antibody-primary-1032 | CDH2 | AB_2683760 | Anti-CDH2 Antibody | polyclonal | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence, NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP | - | Atlas Antibodies | HPA058574 |
| umg-sfb1002-antibody-primary-1037 | HDAC2 | AB_2118543 | Anti-HDAC2 antibody | polyclonal | Synthetic peptide corresponding to Human HDAC2 aa 450 to the C-terminus (internal sequence) conjugated to keyhole limpet haemocyanin. (Peptide available as ab16200, https://www.abcam.com/ab16200.html) | - | Abcam | ab16032 |
| umg-sfb1002-antibody-primary-1038 | RASAL1 | AB_1948369 | RASAL Antibody | polyclonal | The immunogen for this antibody is: C-QERGKAALGPLGP | - | ProSci | 46–269 |
| umg-sfb1002-antibody-primary-1043 | SLC17A7 | AB_2285905 | VGLUT 1/2 | polyclonal | Synthetic peptide corresponding to AA 324 to 339 from rat VGLUT1 (UniProt Id: Q62634) | - | Synaptic Systems | 135 503 |
| umg-sfb1002-antibody-primary-1045 | RIMS1 | AB_887774 | RIM 1 | polyclonal | Recombinant protein corresponding to AA 596 to 705 from rat Rim1 (UniProt Id: Q9JIR4) | - | Synaptic Systems | 140 003 |
| umg-sfb1002-antibody-primary-1049 | GFAP | AB_10001722 | GFAP Antibody | polyclonal | Recombinant full length human GFAP isotype 1 expressed in and purified from E. coli | - | Novus Biologicals | NB300-141 |
| umg-sfb1002-antibody-primary-1050 | TUBA1C | AB_887860 | α-Tubulin | polyclonal | - | Synaptic Systems | 302 203 | |
| umg-sfb1002-antibody-primary-1099 | Junctiphilin 1 | AB_2533470 | JPH1 Polyclonal Antibody | polyclonal | Synthetic peptide derived from the C-terminal region of the mouse junctophilin-1 (JP-1, junctophilin type 1, JPH1) protein, which differs from rat by one non-conservative amino acid replacement | - | ThermoFisher Scientific | 40-5100 |
| umg-sfb1002-antibody-primary-1105 | SNCA | AB_2192953 | α-synuclein Antikörper (C-20) | polyclonal | - | Santa Cruz Biotechnology | sc-7011-R |
