Technical Support: support.menoci@@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Primary antibodies
Search
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | umg-sfb1002-antibody-primary-1461 | RBFOX3 | AB_2619988 | NeuN antibody | polyclonal | Recombinant protein corresponding to AA 1 to 97 from mouse NeuN | - | Synaptic Systems | 266 004 |
| umg-sfb1002-antibody-primary-1462 | GFAP | AB_887720 | GFAP antibody | polyclonal | Recombinant protein corresponding to AA 1 to 432 from human GFAP | - | Synaptic Systems | 173 002 |
| umg-sfb1002-antibody-primary-1476 | MAP2 | AB_91939 | Anti-Microtubule-Associated Protein 2 (MAP2) Antibody | polyclonal | Purified Microtubule-associated protein from rat brain. | - | Millipore | AB5622 |
| umg-sfb1002-antibody-primary-1481 | MDH2 | AB_1853678 | Anti-MDH2 antibody produced in rabbit | polyclonal | VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM | - | Sigma-Aldrich (Atlas Antibodies) | HPA019714 |
| umg-sfb1002-antibody-primary-1482 | MRPL41 | AB_1854112 | Anti-MRPL41 antibody produced in rabbit | polyclonal | KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR | - | Sigma-Aldrich (Atlas Antibodies) | HPA024550 |
| umg-sfb1002-antibody-primary-1483 | MAP2 | AB_2138181 | MAP2 antibody | polyclonal | Recombinant protein corresponding to residues near the amino terminus of human Map2 (UniProt Id: P11137-4) | - | Synaptic Systems | 188 004 |
| umg-sfb1002-antibody-primary-1484 | RPL3 | AB_2181760 | RPL3 Polyclonal antibody | polyclonal | RPL3 fusion protein Ag1436 | - | Proteintech | 11005-1-AP |
| umg-sfb1002-antibody-primary-1485 | RPS3A | AB_2253921 | RPS3A Polyclonal antibody | polyclonal | - | Proteintech | 14123-1-AP | |
| umg-sfb1002-antibody-primary-1486 | TOM70 | AB_2303727 | TOM70 Polyclonal antibody | polyclonal | - | Proteintech | 14528-1-AP | |
| umg-sfb1002-antibody-primary-1491 | C12orf4 | AB_10670531 | Anti-C12orf4 antibody produced in rabbit | polyclonal | KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER | - | Sigma-Aldrich | HPA037871 |
| umg-sfb1002-antibody-primary-1492 | TBCK | AB_10795300 | Anti-TBCK antibody produced in rabbit | polyclonal | LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS | - | Sigma-Aldrich (Atlas Antibodies) | HPA039951 |
| umg-sfb1002-antibody-primary-1493 | MTG2 | AB_10965845 | Anti-MTG2 antibody produced in rabbit | polyclonal | GTP binding protein 5 (putative) recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich | HPA047379 |
| umg-sfb1002-antibody-primary-1494 | MTERF4 | AB_10603879 | Anti-MTERF4 antibody | polyclonal | mitochondrial transcription termination factor 4 | - | Sigma-Aldrich | HPA027097 |
| umg-sfb1002-antibody-primary-1496 | NSUN4 | NSUN4 Polyclonal antibody | polyclonal | NSUN4 fusion protein Ag9402 | - | Proteintech | 16320-1-AP | |
| umg-sfb1002-antibody-primary-1498 | TfR | AB_416601 | Human TfR (Transferrin R) Antibody | polyclonal | Human placenta-derived TfR (Transferrin R) | - | R&D Systems | AF2474 |
| umg-sfb1002-antibody-primary-1501 | SOX2 | AB_792071 | SOX2 Antibody - BSA Free | polyclonal | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] | - | Novus Biologicals | NB110-37235SS |
| umg-sfb1002-antibody-primary-1503 | AB_2056524 | Apolipoprotein AI Polyclonal antibody | polyclonal | - | Proteintech | 14427-1-AP | ||
| umg-sfb1002-antibody-primary-1504 | AP1B1 | AB_2058204 | AP1B1 Polyclonal antibody | polyclonal | AP1B1 fusion protein Ag10417 | - | Proteintech | 16932-1-AP |
| umg-sfb1002-antibody-primary-1505 | DRP1 | AB_2093525 | DRP1 (C-terminal) Polyclonal antibody | polyclonal | DRP1 (C-terminal) fusion protein Ag3644 | - | Proteintech | 12957-1-AP |
| umg-sfb1002-antibody-primary-1506 | EEA1 | AB_2096814 | EEA1 Antibody | polyclonal | synthetic peptide corresponding to residues surrounding Gly14 of human EEA1 protein. | - | Cell Signaling Technology | 2411 |
| umg-sfb1002-antibody-primary-1511 | MYH7 | AB_2736821 | MYH7-specific Polyclonal antibody | polyclonal | Peptide | - | Proteintech | 22280-1-AP |
| umg-sfb1002-antibody-primary-1512 | CCDC53 | AB_2879551 | CCDC53 Polyclonal antibody | polyclonal | - | Proteintech | 24445-1-AP | |
| umg-sfb1002-antibody-primary-1513 | WASL | AB_10638478 | WASL Polyclonal antibody | polyclonal | WASL fusion protein Ag5424 | - | Proteintech | 14306-1-AP |
| umg-sfb1002-antibody-primary-1515 | AB_887725 | GFP antibody | polyclonal | Recombinant protein corresponding to AA 1 to 238 from jellyfish GFP (UniProt Id: P42212) | - | Synaptic Systems | 132 002 | |
| umg-sfb1002-antibody-primary-1517 | NDUFS1 | AB_2282657 | NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial | polyclonal | NDUFS1 fusion protein Ag3135 | - | Proteintech | 12444-1-AP |
