Technical Support: support.menoci@@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Primary antibodies
Search
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | umg-sfb1002-antibody-primary-1464 | His-Tag | AB_2744546 | His-Tag (D3I1O) XP® Rabbit mAb | monoclonal | Antibody recognizes 6xHis-tag fused to either the amino or carboxy terminus of targeted proteins in transfected cells. | - | Cell Signaling Technology | 12698 |
| umg-sfb1002-antibody-primary-1472 | ALFA | FluoTag-X2 anti-ALFA HRP | monoclonal | - | NanoTag Biotechnology | N1502-HRP | ||
| umg-sfb1002-antibody-primary-1473 | CALM1 | AB_725815 | Anti-Calmodulin 1/2/3 antibody | monoclonal | Synthetic peptide within Human Calmodulin 1/2/3 aa 100 to the C-terminus. | - | Abcam | ab45689 |
| umg-sfb1002-antibody-primary-1474 | HA | AB_390918 | Anti-HA mit hoher Affinität | monoclonal | Amino acids 98-106 from the human influenza virus hemagglutinin protein | - | Merck | 11867423001 |
| umg-sfb1002-antibody-primary-1475 | ACTB | AB_476743 | Monoclonal Anti-β-Actin antibody produced in mouse | monoclonal | slightly modified β-cytoplasmic actin N-terminal peptide, Ac-Asp-Asp-Asp-Ile-Ala-Ala-Leu-Val-Ile-Asp-Asn-Gly-Ser-Gly-Lys, conjugated to KLH. | - | Sigma-Aldrich | A5316 |
| umg-sfb1002-antibody-primary-1476 | MAP2 | AB_91939 | Anti-Microtubule-Associated Protein 2 (MAP2) Antibody | polyclonal | Purified Microtubule-associated protein from rat brain. | - | Millipore | AB5622 |
| umg-sfb1002-antibody-primary-1479 | Rab5 | AB_398048 | Purified Mouse Anti-Rab5 | monoclonal | Human Rab5 aa. 1-215 | - | BD Biosciences | 610725 |
| umg-sfb1002-antibody-primary-1480 | GAPDH | Anti-GAPDH antibody, Mouse monoclonal | monoclonal | - | Sigma-Aldrich | G8795 | ||
| umg-sfb1002-antibody-primary-1481 | MDH2 | AB_1853678 | Anti-MDH2 antibody produced in rabbit | polyclonal | VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM | - | Sigma-Aldrich (Atlas Antibodies) | HPA019714 |
| umg-sfb1002-antibody-primary-1482 | MRPL41 | AB_1854112 | Anti-MRPL41 antibody produced in rabbit | polyclonal | KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR | - | Sigma-Aldrich (Atlas Antibodies) | HPA024550 |
| umg-sfb1002-antibody-primary-1483 | MAP2 | AB_2138181 | MAP2 antibody | polyclonal | Recombinant protein corresponding to residues near the amino terminus of human Map2 (UniProt Id: P11137-4) | - | Synaptic Systems | 188 004 |
| umg-sfb1002-antibody-primary-1484 | RPL3 | AB_2181760 | RPL3 Polyclonal antibody | polyclonal | RPL3 fusion protein Ag1436 | - | Proteintech | 11005-1-AP |
| umg-sfb1002-antibody-primary-1485 | RPS3A | AB_2253921 | RPS3A Polyclonal antibody | polyclonal | - | Proteintech | 14123-1-AP | |
| umg-sfb1002-antibody-primary-1486 | TOM70 | AB_2303727 | TOM70 Polyclonal antibody | polyclonal | - | Proteintech | 14528-1-AP | |
| umg-sfb1002-antibody-primary-1490 | NEFH | AB_2715851 | Purified anti-Neurofilament H (NF-H), Phosphorylated Antibody | monoclonal | - | Biolegend | 801601 | |
| umg-sfb1002-antibody-primary-1491 | C12orf4 | AB_10670531 | Anti-C12orf4 antibody produced in rabbit | polyclonal | KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER | - | Sigma-Aldrich | HPA037871 |
| umg-sfb1002-antibody-primary-1492 | TBCK | AB_10795300 | Anti-TBCK antibody produced in rabbit | polyclonal | LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS | - | Sigma-Aldrich (Atlas Antibodies) | HPA039951 |
| umg-sfb1002-antibody-primary-1493 | MTG2 | AB_10965845 | Anti-MTG2 antibody produced in rabbit | polyclonal | GTP binding protein 5 (putative) recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich | HPA047379 |
| umg-sfb1002-antibody-primary-1494 | MTERF4 | AB_10603879 | Anti-MTERF4 antibody | polyclonal | mitochondrial transcription termination factor 4 | - | Sigma-Aldrich | HPA027097 |
| umg-sfb1002-antibody-primary-1495 | RPL3 | AB_2881529 | RPL3 Monoclonal antibody | monoclonal | RPL3 fusion protein Ag20400 | - | Proteintech | 66130-1-Ig |
| umg-sfb1002-antibody-primary-1496 | NSUN4 | NSUN4 Polyclonal antibody | polyclonal | NSUN4 fusion protein Ag9402 | - | Proteintech | 16320-1-AP | |
| umg-sfb1002-antibody-primary-1497 | SSEA-4 | AB_357704 | Human/Mouse SSEA-4 Antibody | monoclonal | 2120Ep human embryonal carcinoma cell line | - | R&D Systems | MAB1435 |
| umg-sfb1002-antibody-primary-1498 | TfR | AB_416601 | Human TfR (Transferrin R) Antibody | polyclonal | Human placenta-derived TfR (Transferrin R) | - | R&D Systems | AF2474 |
| umg-sfb1002-antibody-primary-1499 | AB_427225 | Purified Anti-PtdIns(4,5)P2 IgM | monoclonal | - | Z-P045 | |||
| umg-sfb1002-antibody-primary-1500 | TNNC1 | AB_675914 | Troponin C slow skeletal/cardiac Antikörper (12G3) | monoclonal | cardiac Troponin C of human origin | - | Santa Cruz Biotechnology | sc-52263 |
