Technical Support: sfb1002-support@gwdg.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
umg-sfb1002-antibody-primary-1491 | C12orf4 | AB_10670531 | Anti-C12orf4 antibody produced in rabbit | polyclonal | KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER | - | Sigma-Aldrich | HPA037871 | |
umg-sfb1002-antibody-primary-1490 | NEFH | AB_2715851 | Purified anti-Neurofilament H (NF-H), Phosphorylated Antibody | monoclonal | - | Biolegend | 801601 | ||
umg-sfb1002-antibody-primary-1486 | TOM70 | AB_2303727 | TOM70 Polyclonal antibody | polyclonal | - | Proteintech | 14528-1-AP | ||
umg-sfb1002-antibody-primary-1485 | RPS3A | AB_2253921 | RPS3A Polyclonal antibody | polyclonal | - | Proteintech | 14123-1-AP | ||
umg-sfb1002-antibody-primary-1484 | RPL3 | AB_2181760 | RPL3 Polyclonal antibody | polyclonal | RPL3 fusion protein Ag1436 | - | Proteintech | 11005-1-AP | |
umg-sfb1002-antibody-primary-1483 | MAP2 | AB_2138181 | MAP2 antibody | polyclonal | Recombinant protein corresponding to residues near the amino terminus of human Map2 (UniProt Id: P11137-4) | - | Synaptic Systems | 188 004 | |
umg-sfb1002-antibody-primary-1482 | MRPL41 | AB_1854112 | Anti-MRPL41 antibody produced in rabbit | polyclonal | KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR | - | Sigma-Aldrich (Atlas Antibodies) | HPA024550 | |
umg-sfb1002-antibody-primary-1481 | MDH2 | AB_1853678 | Anti-MDH2 antibody produced in rabbit | polyclonal | VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM | - | Sigma-Aldrich (Atlas Antibodies) | HPA019714 | |
umg-sfb1002-antibody-primary-1480 | GAPDH | Anti-GAPDH antibody, Mouse monoclonal | monoclonal | - | Sigma-Aldrich | G8795 | |||
umg-sfb1002-antibody-primary-1479 | Rab5 | AB_398048 | Purified Mouse Anti-Rab5 | monoclonal | Human Rab5 aa. 1-215 | - | BD Biosciences | 610725 | |
umg-sfb1002-antibody-primary-1476 | MAP2 | AB_91939 | Anti-Microtubule-Associated Protein 2 (MAP2) Antibody | polyclonal | Purified Microtubule-associated protein from rat brain. | - | Millipore | AB5622 | |
umg-sfb1002-antibody-primary-1475 | ACTB | AB_476743 | Monoclonal Anti-β-Actin antibody produced in mouse | monoclonal | slightly modified β-cytoplasmic actin N-terminal peptide, Ac-Asp-Asp-Asp-Ile-Ala-Ala-Leu-Val-Ile-Asp-Asn-Gly-Ser-Gly-Lys, conjugated to KLH. | - | Sigma-Aldrich | A5316 | |
umg-sfb1002-antibody-primary-1474 | HA | AB_390918 | Anti-HA mit hoher Affinität | monoclonal | Amino acids 98-106 from the human influenza virus hemagglutinin protein | - | Merck | 11867423001 | |
umg-sfb1002-antibody-primary-1473 | CALM1 | AB_725815 | Anti-Calmodulin 1/2/3 antibody | monoclonal | Synthetic peptide within Human Calmodulin 1/2/3 aa 100 to the C-terminus. | - | Abcam | ab45689 | |
umg-sfb1002-antibody-primary-1472 | ALFA | FluoTag-X2 anti-ALFA HRP | monoclonal | - | NanoTag Biotechnology | N1502-HRP | |||
umg-sfb1002-antibody-primary-1464 | His-Tag | AB_2744546 | His-Tag (D3I1O) XP® Rabbit mAb | monoclonal | Antibody recognizes 6xHis-tag fused to either the amino or carboxy terminus of targeted proteins in transfected cells. | - | Cell Signaling Technology | 12698 | |
umg-sfb1002-antibody-primary-1463 | MBP | AB_2799920 | Myelin Basic Protein (D8X4Q) XP® Rabbit mAb | monoclonal | Myelin Basic Protein (D8X4Q) XP® Rabbit mAb recognizes endogenous levels of total myelin basic protein. | - | Cell Signaling Technology | 78896 | |
umg-sfb1002-antibody-primary-1462 | GFAP | AB_887720 | GFAP antibody | polyclonal | Recombinant protein corresponding to AA 1 to 432 from human GFAP | - | Synaptic Systems | 173 002 | |
umg-sfb1002-antibody-primary-1461 | RBFOX3 | AB_2619988 | NeuN antibody | polyclonal | Recombinant protein corresponding to AA 1 to 97 from mouse NeuN | - | Synaptic Systems | 266 004 | |
umg-sfb1002-antibody-primary-1460 | RAB11B | AB_10861613 | Anti-RAB11B antibody | polyclonal | Synthetic peptide corresponding to Human RAB11B aa 1-100. | - | Abcam | ab3612 | |
umg-sfb1002-antibody-primary-1459 | RAB11A | AB_2173452 | Rab11a Antibody | polyclonal | Rab11a Antibody detects endogenous levels of total Rab11a protein. | - | Cell Signaling Technology | 2413 | |
umg-sfb1002-antibody-primary-1458 | ITGB1 | AB_395637 | Purified Hamster Anti-Rat CD29 | monoclonal | Rat glomerular epithelial cells | - | BD Biosciences | 555003 | |
umg-sfb1002-antibody-primary-1457 | ITGB1 | AB_10894590 | FITC Hamster Anti-Rat CD29 | monoclonal | Rat glomerular epithelial cells | - | BD Biosciences | 561796 | |
umg-sfb1002-antibody-primary-1456 | RBFOX3 | AB_2713971 | NeuN antibody | monoclonal | Recombinant protein corresponding to AA 1 to 97 from mouse NeuN | - | Synaptic Systems | 266 011 | |
umg-sfb1002-antibody-primary-1455 | TGOLN2 | AB_796176 | Anti-TGN38 antibody | polyclonal | Synthetic peptide corresponding to amino acid residues of rat TGN38 with C-terminal added cysteine, conjugated to KLH. | - | Sigma-Aldrich | T9826 |