Technical Support: support.menoci@@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
![]() | umg-sfb1002-antibody-primary-1328 | AB_2121151 | Anti-Ras, clone RAS10 antibody | monoclonal | Ras | - | Millipore | 05-516 | |
![]() | umg-sfb1002-antibody-primary-1524 | anti-RIESKE | unknown | - | 1512 | ||||
![]() | umg-sfb1002-antibody-primary-1318 | RYR2 | AB_10746831 | Anti-RYR2 antibody | polyclonal | - | Sigma Aldrich | SAB4502707 | |
![]() | umg-sfb1002-antibody-primary-555 | RYR2 | AB_1856528 | Anti-RYR2 antibody produced in rabbit | polyclonal | Ryanodine receptor 2 recombinant protein epitope signature tag (PrEST) | - icc | Sigma-Aldrich | HPA020028 |
![]() | umg-sfb1002-antibody-primary-1440 | SARS2 | Anti-SARS2 antibody | polyclonal | Recombinant fragment within Human SARS2 (internal sequence). | - | Abcam | ab229227 | |
![]() | umg-sfb1002-antibody-primary-893 | SCN1A | AB_2040003 | Anti-SCN1A (NaV1.1) | polyclonal | - | Alomone Labs | ASC-001 | |
![]() | umg-sfb1002-antibody-primary-895 | SCN1B | anti-SCN1B | polyclonal | central sequence of human SCN1B | - | Cell Applications, inc. | CA1705 | |
![]() | umg-sfb1002-antibody-primary-234 | SHISA3 | AB_2682593 | Anti-SHISA3 antibody produced in rabbit | polyclonal | Shisa homolog 3 (Xenopus laevis) recombinant protein epitope signature tag (PrEST) | - WB | Sigma-Aldrich | HPA054754 |
![]() | umg-sfb1002-antibody-primary-1228 | SNAP23 | AB_887788 | Anti-SNAP 23 antibody | polyclonal | Synthetic peptide corresponding to AA 196 to 211 from human SNAP23 | - | Synaptic Systems | 111 202 |
![]() | umg-sfb1002-antibody-primary-1229 | SNAP25 | AB_887794 | Anti-SNAP 25 antibody | monoclonal | Recombinant protein corresponding to AA 1 to 206 from rat SNAP25B | - | Synaptic Systems | 111 011 |
![]() | umg-sfb1002-antibody-primary-1230 | SNAP29 | AB_1142975 | Anti-SNAP29 antibody | polyclonal | A synthetic peptide from part of rat SNAP29, conjugated to an immunogenic carrier protein | - | Abcam | ab68824 |
![]() | umg-sfb1002-antibody-primary-1209 | SNX27 | AB_10673818 | Anti-SNX27 antibody | monoclonal | Fusion protein corresponding to Human SNX27 aa 1-300 (N terminal). | - | Abcam | ab77799 |
![]() | umg-sfb1002-antibody-primary-993 | SOX2 | AB_945584 | Anti-SOX2 antibody - ChIP Grade | polyclonal | Synthetic peptide made from the N-terminal region of human SOX2 protein within residues 1-100. | - | Abcam | ab59776 |
![]() | umg-sfb1002-antibody-primary-997 | AB_870663 | Anti-SSEA1 anibody [MC-480] | monoclonal | Tissue, cells or virus corresponding to Mouse SSEA1. The mouse was immunized with F9 teratocarcinoma cells | - | Abcam | ab16285 | |
![]() | umg-sfb1002-antibody-primary-994 | DPPA3 | AB_2246120 | Anti-STELLAR antibody | polyclonal | Synthetic peptide corresponding to Mouse STELLAR aa 100 to the C-terminus (C terminal) conjugated to keyhole limpet haemocyanin. (Peptide available as ab23324, https://www.abcam.com/ab23324.html) | - | Abcam | ab19878 |
![]() | umg-sfb1002-antibody-primary-1234 | VAMP1 | AB_887807 | Anti-Synaptobrevin antibody | polyclonal | Synthetic peptide corresponding to AA 2 to 14 from rat Synaptobrevin1 | - | Synaptic Systems | 104 002 |
![]() | umg-sfb1002-antibody-primary-1231 | SYNGR1 | AB_887818 | Anti-Synaptogyrin 1 antibody | polyclonal | Synthetic peptide corresponding to AA 220 to 234 from rat Synaptogyrin1 | - | Synaptic Systems | 103 002 |
![]() | umg-sfb1002-antibody-primary-1447 | SYT1 | AB_2619765 | Anti-Synaptotagmin 1 antibody | polyclonal | Synthetic peptide corresponding to AA 1 to 8 from mouse Synaptotagmin1 | - | Synaptic Systems | 105 103C2 |
![]() | umg-sfb1002-antibody-primary-1232 | SYT7 | AB_887838 | Anti-Synaptotagmin 7 antibody | polyclonal | Recombinant protein corresponding to AA 46 to 133 from rat Synaptotagmin7 | - | Synaptic Systems | 105 173 |
![]() | umg-sfb1002-antibody-primary-1530 | TACO1 | anti-TACO1 | unknown | - | 3628 | |||
![]() | umg-sfb1002-antibody-primary-1492 | TBCK | AB_10795300 | Anti-TBCK antibody produced in rabbit | polyclonal | LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS | - | Sigma-Aldrich (Atlas Antibodies) | HPA039951 |
![]() | umg-sfb1002-antibody-primary-939 | TCF7L2 | AB_1310728 | Anti-TCF-4/TCF7L2 antibody [EP2033Y] | monoclonal | Synthetic peptide within Human TCF-4/TCF7L2 aa 1-100 (N terminal). The exact sequence is proprietary. Database link: http://www.uniprot.org/uniprot/Q9NQB0 | - | Abcam | ab76151 |
![]() | umg-sfb1002-antibody-primary-1445 | TNR | AB_2256347 | Anti-Tenascin-R antibody | monoclonal | Recombinant protein corresponding to AA 1 to 1211 from bovine Tenascin-R | - | Synaptic Systems | 217 011 |
![]() | umg-sfb1002-antibody-primary-1455 | TGOLN2 | AB_796176 | Anti-TGN38 antibody | polyclonal | Synthetic peptide corresponding to amino acid residues of rat TGN38 with C-terminal added cysteine, conjugated to KLH. | - | Sigma-Aldrich | T9826 |
![]() | umg-sfb1002-antibody-primary-1531 | TIM21 | anti-TIM21 | unknown | - | 3674 |