Technical Support: sfb1002-support@gwdg.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Primary antibodies
Search
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | umg-sfb1002-antibody-primary-942 | BAT1 | BAT1 (YHR208W) | unknown | - | Peter Rehling, Georg-August-University Göttingen, Germany | |||
| umg-sfb1002-antibody-primary-941 | BMH1 | BMH1 (YER177W) | unknown | - | Peter Rehling, Georg-August-University Göttingen, Germany | |||
| umg-sfb1002-antibody-primary-987 | BMPR1A | AB_2064088 | BMPR-IA Antikörper (E-16) | polyclonal | - | Santa Cruz Biotechnology | sc-5676 | |
| umg-sfb1002-antibody-primary-988 | BMPR1A | AB_2064083 | BMPR-IA Antikörper (H-60) | polyclonal | - | Santa Cruz Biotechnology | sc-20736 | |
| umg-sfb1002-antibody-primary-989 | BMPR2 | AB_10865487 | Anti-BMPR2 antibody | polyclonal | Recombinate fragment, corresponding to amino acids 295 - 552 of Human BMPR2 (BC052985). | - | Abcam | ab106266 |
| umg-sfb1002-antibody-primary-1210 | BSN | AB_887698 | Bassoon antibody | polyclonal | Recombinant protein corresponding to AA 3608 to 3938 from rat Bassoon | - | Synaptic Systems | 141 002 |
| umg-sfb1002-antibody-primary-1211 | BSN | AB_2066979 | Anti-Bassoon antibody | monoclonal | Recombinant protein corresponding to AA 3608 to 3938 from rat Bassoon | - | Synaptic Systems | 141 021 |
| umg-sfb1002-antibody-primary-1236 | BSN | AB_10618753 | Bassoon monoclonal antibody | monoclonal | Recombinant rat Bassoon. | - | Enzo Life Sciences | ADI-VAM-PS003 |
| umg-sfb1002-antibody-primary-1491 | C12orf4 | AB_10670531 | Anti-C12orf4 antibody produced in rabbit | polyclonal | KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER | - | Sigma-Aldrich | HPA037871 |
| umg-sfb1002-antibody-primary-1535 | C12ORF62 | anti-C12ORF62 | unknown | - | 4844 | |||
| umg-sfb1002-antibody-primary-1540 | C12ORF73 | anti-C12ORF73 | unknown | - | 5104 | |||
| umg-sfb1002-antibody-primary-953 | CACNA1C | AB_879800 | Anti-CACNA1C antibody | polyclonal | Synthetic peptide corresponding to Rat CACNA1C aa 818-835 conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence:C-TTKINMDDLQPSENEDKS | - | Abcam | ab58552 |
| umg-sfb1002-antibody-primary-954 | CACNA1C | AB_2039771 | Anti-CaV1.2 (CACNA1C) Antibody - Voltage-dependent L-type calcium channel subunit α1C | polyclonal | Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002, http://www.uniprot.org/uniprot/P22002). Intracellular loop between domains II and III. | - | Alomone Labs | ACC-003 |
| umg-sfb1002-antibody-primary-955 | CACNA1D | AB_2039775 | Anti-CaV1.3 (CACNA1D) Antibody - Voltage-dependent L-type calcium channel subunit α1D | polyclonal | Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3 (Accession P27732, http://www.uniprot.org/uniprot/P27732). Intracellular loop between domains II and III. | - | Alomone Labs | ACC-005 |
| umg-sfb1002-antibody-primary-1216 | CALM1 | AB_837786 | Calmodulin Antibody | monoclonal | A synthetic peptide corresponding to residues in the C-terminus of human Calmodulin was used as immunogen. | - | Novus Biologicals | NB110-55649 |
| umg-sfb1002-antibody-primary-1473 | CALM1 | AB_725815 | Anti-Calmodulin 1/2/3 antibody | monoclonal | Synthetic peptide within Human Calmodulin 1/2/3 aa 100 to the C-terminus. | - | Abcam | ab45689 |
| umg-sfb1002-antibody-primary-1448 | CALM3 | AB_2069438 | Calmodulin Monoclonal Antibody | monoclonal | Calmodulin purified from Dictyostelium discoideum. | - | Thermo Fisher Scientific (Invitrogen) | MA3-917 |
| umg-sfb1002-antibody-primary-1452 | CALR | AB_2688013 | Calreticulin (D3E6) XP® Antibody | monoclonal | Calreticulin (D3E6) XP® Rabbit mAb recognizes endogenous levels of total calreticulin protein. | - | Cell Signaling Technology | 12238 |
| umg-sfb1002-antibody-primary-1016 | CAMK2A | AB_325402 | Phospho-CaMKII alpha (Thr286) Monoclonal Antibody (22B1) | monoclonal | Synthetic peptide corresponding to residues M(281) H R Q E T(p) V D C L K K F N(294) of rat CaM Kinase II protein. | - | ThermoFisher Scientific | MA1-047 |
| umg-sfb1002-antibody-primary-1244 | CAMK2B | AB_725893 | anti-CaMKII phospho T286 | polyclonal | - | Abcam | ab32678 | |
| umg-sfb1002-antibody-primary-1249 | CaMKII | AB_11153337 | CaMKII delta Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific | PA5-22168 | |
| umg-sfb1002-antibody-primary-821 | CAMLG | AB_2620119 | calcium modulating ligand | polyclonal | - | Synaptic Systems | 359 004 | |
| umg-sfb1002-antibody-primary-1304 | CAPN1 | AB_634533 | Calpain 1 (C-20) antibody | polyclonal | - | Santa Cruz Biotechnology | sc-7530 | |
| umg-sfb1002-antibody-primary-1419 | CAPN1 | AB_10610038 | Anti-Calpain 1 Antibody (D-11) | monoclonal | specific for an epitope mapping between amino acids 8-33 near the N-terminus of Calpain 1 of human origin | - | Santa Cruz Biotechnology | sc-271313 |
| umg-sfb1002-antibody-primary-1420 | CAPN2 | AB_2290818 | Calpain Antibody (H-240) | polyclonal | epitope corresponding to amino acids 61-299 mapping near the N-terminus of Calpain 2 of human origin | - | Santa Cruz Biotechnology | sc-30064 |
