Technical Support: sfb1002-support@gwdg.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | umg-sfb1002-antibody-primary-1290 | ACTB | AB_626632 | β-Actin Antibody | monoclonal | β-Actin | - | Santa Cruz Biotechnology | sc-47778 |
![]() | umg-sfb1002-antibody-primary-848 | GAPDH | AB_796208 | Anti-GAPDH | polyclonal | ~36 kDa | - | Sigma-Aldrich | G9545 |
![]() | umg-sfb1002-antibody-primary-1426 | IMMT | AB_2127209 | Mitofilin Antibody | polyclonal | Whole human recombinant Mitofilin | - | Novus Biologicals | NB100‐1919 |
![]() | umg-sfb1002-antibody-primary-1513 | WASL | AB_10638478 | WASL Polyclonal antibody | polyclonal | WASL fusion protein Ag5424 | - | Proteintech | 14306-1-AP |
![]() | umg-sfb1002-antibody-primary-1481 | MDH2 | AB_1853678 | Anti-MDH2 antibody produced in rabbit | polyclonal | VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM | - | Sigma-Aldrich (Atlas Antibodies) | HPA019714 |
![]() | umg-sfb1002-antibody-primary-977 | AB_2556564 | V5 Tag Monoclonal Antibody | monoclonal | V5 synthetic peptide: Gly-Lys-Pro-Ile-Pro-Asn-Pro-Leu-Leu-Gly-Leu-Asp-Ser-Thr-. | - | ThermoFisher Scientific | R960-25 | |
![]() | umg-sfb1002-antibody-primary-1347 | AB_306074 | Mouse Anti-Tropomyosin Monoclonal Antibody, Unconjugated, Clone TM311 | monoclonal | Tropomyosin | - | Abcam | ab7785 | |
![]() | umg-sfb1002-antibody-primary-1262 | AB_2536702 | TRA-1-60 Monoclonal Antibody (TRA-1-60), DyLight 650 | monoclonal | TRA-1-60 | - | Thermo Fisher Scientific | MA1-023-D650 | |
![]() | umg-sfb1002-antibody-primary-1279 | AB_1645379 | Alexa Fluor® 488 Mouse anti-Human TRA-1-60 Antigen Clone TRA-1-60 antibody | unknown | TRA-1-60 | - | BD Biosciences | 560173 | |
![]() | umg-sfb1002-antibody-primary-1375 | TOMM20 | AB_2207530 | TOM20 Polyclonal antibody | polyclonal | TOM20 fusion protein Ag2378 | - | Proteintech | 11802-1-AP |
![]() | umg-sfb1002-antibody-primary-1403 | TOMM20 | AB_2882123 | TOM20 Monoclonal antibody | monoclonal | TOM20 fusion protein Ag2378 | - | Proteintech | 66777-1-Ig |
![]() | umg-sfb1002-antibody-primary-1338 | AB_2734750 | TTN-9 antibody | polyclonal | Titin | - | MyoMedix | TTN-9 | |
![]() | umg-sfb1002-antibody-primary-997 | AB_870663 | Anti-SSEA1 anibody [MC-480] | monoclonal | Tissue, cells or virus corresponding to Mouse SSEA1. The mouse was immunized with F9 teratocarcinoma cells | - | Abcam | ab16285 | |
![]() | umg-sfb1002-antibody-primary-937 | TUBA1A | AB_448182 | Anti-alpha Tubulin (acetyl K40) antibody [6-11B-1] | monoclonal | Tissue, cells or virus corresponding to alpha Tubulin. The antibody recognizes an epitope located on the a3 isoform of Chlamydomonas axonemal a-tubulin, within four residues of Lys40 when this amino acid is ace | - | Abcam | ab24610 |
![]() | umg-sfb1002-antibody-primary-1366 | TIAM1 | AB_2240410 | Tiam1 (C-16) antibody | polyclonal | Tiam1 (C-16) | - | Santa Cruz Biotechnology | sc-872 |
![]() | umg-sfb1002-antibody-primary-995 | AB_2615077 | Histone H3K4me3 antibody | polyclonal | This Histone H3 trimethyl Lys4 antibody was raised against a peptide including trimethyl-lysine 4 of histone H3. | - | Active Motif | 39159 | |
![]() | umg-sfb1002-antibody-primary-965 | HIF1A | AB_10000633 | HIF-1 alpha Antibody | polyclonal | This HIF-1 alpha Antibody was developed against a fusion protein including amino acids 530 - 825 of the mouse HIF-1 alpha protein [Uniprot# Q61221]. | - | Novus Biologicals | NB100-479 |
![]() | umg-sfb1002-antibody-primary-845 | AB_303395 | Anti-GFP antibody | polyclonal | This anti-GFP antibody recognizes the enhanced form of GFP as well. Recognises EYFP (Yellow Fluorescent Protein (YFP), a genetic mutant of green fluorescent protein (GFP). ab290 also detects venus YFP. | - | Abcam | ab290 | |
![]() | umg-sfb1002-antibody-primary-1038 | RASAL1 | AB_1948369 | RASAL Antibody | polyclonal | The immunogen for this antibody is: C-QERGKAALGPLGP | - | ProSci | 46–269 |
![]() | umg-sfb1002-antibody-primary-1177 | GFP Monoclonal Antibody (3E6) | AB_221568 | GFP Monoclonal Antibody (3E6) | monoclonal | The GFP was isolated directly from the jellyfish Aequorea victoria. | - | Invitrogen | A11120 |
![]() | umg-sfb1002-antibody-primary-1039 | AB_305426 | Anti-BrdU antibody [BU1/75 (ICR1)] | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab6326 | |
![]() | umg-sfb1002-antibody-primary-1402 | TFAM | AB_11182588 | TFAM Polyclonal antibody | polyclonal | TFAM fusion protein Ag18299 | - | Proteintech | 22586-1-AP |
![]() | umg-sfb1002-antibody-primary-1398 | HSPB1 | AB_2797466 | HSP27 (phospho-S15) polyclonal antibody | polyclonal | Synthetic phosphopeptide derived from human HSP27 around the phosphorylation site of Serine 15. | - | Bioworld Technology | AP0245 |
![]() | umg-sfb1002-antibody-primary-926 | PPP1R3A | AB_11014462 | PPP1R3A | polyclonal | Synthetic peptides corresponding to PPP1R3A(protein phosphatase 1, regulatory (inhibitor) subunit 3A) The peptide sequence was selected from the N terminal of PPP1R3A. Peptide sequence MEPSEVPSQISKDNFLEVPNLSDSL | - | Novus Biologicals | NBP1-59934 |
![]() | umg-sfb1002-antibody-primary-1514 | MYBPC3 | AB_10865856 | Recombinant Anti-MYBPC3 antibody [EPR3008(2)] | monoclonal | Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. | - | Abcam | ab108522 |